Select Type of Degree:

Select State:

About Biophysics

A program that focuses on the application of physics principles to the scientific study of the mechanisms of biological processes and assemblies at all levels of complexity. Includes instruction in research methods and equipment operation and applications to subjects such as bioenergetics, biophysical theory and modeling, electrophysics, membrane biology, channels, receptors and transporters, contractility and muscle function, protein shaping and folding, molecular and supramolecular structures and assemblies, and computational science.

Maryland awards the most Bachelors degrees in Biophysics of all US states with 38 degrees being granted last year. Students wanting to major in Biophysics can expect around 56% percent of their fellow classmates to be men and 44% percent to be women. The majority students graduating in this field earn a Doctors degree research scholarship. The average starting salary for an undergraduate degree in Biophysics is $44,700.

Popularity of Biophysics Degrees in the U.S.
This heat map represents the states that have the highest percent of Biophysics degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Careers

Some top jobs related to Biophysics, include Medical Scientists, Except Epidemiologists and Biochemists and Biophysicists, both of which have many employment opportunities. Yet there are higher paying positions, such as Natural Sciences Managers. the most in-demand position for Biophysics majors is Natural Sciences Managers.

Top Paying Careers

These are the highest paying careers for Biophysics majors.

Most In-Demand Careers

These are the careers in highest demand for Biophysics majors.

Student Demographics

Total Students
132
Female Students
58 (43%)
Male Students
74 (56%)
White (59, 45%)
Asian (30, 23%)
Hispanic or Latino (13, 10%)
Two or more races (11, 8%)
U.S. Nonresident (9, 7%)
Black or African American (5, 4%)
Race/ethnicity unknown (4, 3%)
American Indian or Alaska Native (1, 1%)
Native Hawaiian or Other Pacific Islander (0, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen