Select Type of Degree:

Select State:

About Immunology

A program that focuses on scientific study of the biological mechanisms involved in the pathogenesis of disease, host-pathogen interactions, and host response to disease. Includes instruction in antigen and antibody structure and function, effector mechanisms, receptors, histocompatibility, host-pathogen recognition, disease modeling, autoimmune systems, antibody formation, cytotoxic responses, regulation of immune response, virulence determinants, intercellular signaling, immunosuppression, immunotherapy, immunogenetics, disease markers, transplantation, antibody humanization, and microbial pathogenesis.

Students majoring in Immunology can advance up to a Masters degree. On average, 43% percent of men and 57% percent of women make up the degrees awarded across all college campuses. Immunology is most common in Texas. The Median Starting Salary for an undergraduate degree in Immunology is $44,600.

Popularity of Immunology Degrees in the U.S.
This heat map represents the states that have the highest percent of Immunology degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Careers

Majoring in Immunology, your education can be applied to different careers. Immunology majors go on to pursue jobs including Medical Scientists, Except Epidemiologists and Biological Science Teachers, Postsecondary which are in high demand. Some of the jobs with the highest salary for Immunology majors include Natural Sciences Managers, Medical Scientists, Except Epidemiologists and Biological Scientists, All Other.

Top Paying Careers

These are the highest paying careers for Immunology majors.

Most In-Demand Careers

These are the careers in highest demand for Immunology majors.

Student Demographics

Total Students
147
Female Students
84 (57%)
Male Students
63 (42%)
White (65, 44%)
U.S. Nonresident (28, 19%)
Asian (26, 18%)
Two or more races (12, 8%)
Hispanic or Latino (6, 4%)
Black or African American (5, 3%)
Race/ethnicity unknown (4, 3%)
American Indian or Alaska Native (1, 1%)
Native Hawaiian or Other Pacific Islander (0, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen