Select Type of Degree:

Select State:

About Biotechnology

A program that focuses on the application of the biological sciences, biochemistry, and genetics to the preparation of new and enhanced agricultural, environmental, clinical, and industrial products, including the commercial exploitation of microbes, plants, and animals. Includes instruction in bioinformatics, gene identification, phylogenetics and comparative genomics, bioinorganic chemistry, immunoassaying, DNA sequencing, xenotransplantation, genetic engineering, industrial microbiology, drug and biologic development, enzyme-based production processes, patent law, biotechnology management and marketing, applicable regulations, and biotechnology ethics.

Students who are passionate about Biotechnology can study up to a Post masters certificate. Currently, 2,968 students are granted some level of degree in Biotechnology around the US each year. More students graduate with a degree in Biotechnology in the state of Maryland compared to any other state. The average starting salary for a graduate with a bachelor's degree in Biotechnology is $42,090.

Popularity of Biotechnology Degrees in the U.S.
This heat map represents the states that have the highest percent of Biotechnology degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Careers

The highest paying job for Biotechnology majors is Natural Sciences Managers. However, something else to think about is how many job openings there currently is. A position that is in high need that a degree in Biotechnology can prepare you for is Natural Sciences Managers.

Top Paying Careers

These are the highest paying careers for Biotechnology majors.

Most In-Demand Careers

These are the careers in highest demand for Biotechnology majors.

Student Demographics

Total Students
100
Female Students
63 (63%)
Male Students
37 (37%)
White (33, 33%)
Asian (24, 24%)
Hispanic or Latino (14, 14%)
Black or African American (11, 11%)
U.S. Nonresident (11, 11%)
Race/ethnicity unknown (6, 6%)
American Indian or Alaska Native (1, 1%)
Native Hawaiian or Other Pacific Islander (0, <1%)
Two or more races (0, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen