Biology Technician/Biotechnology Laboratory Technician

Select Type of Degree:

Select State:

About Biology Technician/Biotechnology Laboratory Technician

Biology Technician/Biotechnology Laboratory Technician programs prepare individuals to apply scientific principles and technical skills in support of biologists and biotechnologists in research, industrial, and government settings. Includes instruction in fermentation technology, cell culturing, protein purification, biologic synthesis, assaying and testing, quality control, industrial microbiology, bioprocessing, chromatography and bioseparation, genetic technology, laboratory and hazardous materials safety, and computer applications.

For all the 537 degrees granted in Biology Technician/Biotechnology Laboratory Technician per year, the majority of them are Award of at least 1 but less than 2 academic years. Of the 279 students graduating with degrees at the Associates degree level in the US, 65% percent identify as women and 35% percent identify as men. While students at schools all over the country study Biology Technician/Biotechnology Laboratory Technician, Massachusetts has the most graduates. The average annual income for an undergraduate degree in Biology Technician/Biotechnology Laboratory Technician is $0.

Popularity of Biology Technician/Biotechnology Laboratory Technician Degrees in the U.S.
This heat map represents the states that have the highest percent of Biology Technician/Biotechnology Laboratory Technician degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Careers

The highest paying career for Biology Technician/Biotechnology Laboratory Technician majors is Biological Technicians. However, something else to consider is how much demand there is for specific jobs. A job that is in high need that a degree in Biology Technician/Biotechnology Laboratory Technician can prepare you for is Biological Technicians.

Top Paying Careers

These are the highest paying careers for Biology Technician/Biotechnology Laboratory Technician majors.

Most In-Demand Careers

These are the careers in highest demand for Biology Technician/Biotechnology Laboratory Technician majors.

Student Demographics

Total Students
279
Female Students
181 (64%)
Male Students
98 (35%)
White (127, 46%)
Hispanic or Latino (47, 17%)
Asian (32, 11%)
Black or African American (30, 11%)
Two or more races (17, 6%)
U.S. Nonresident (15, 5%)
Race/ethnicity unknown (9, 3%)
American Indian or Alaska Native (2, 1%)
Native Hawaiian or Other Pacific Islander (0, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen