Select Type of Degree:

Select State:

About Medicinal and Pharmaceutical Chemistry

A program that focuses on the application of chemistry to the study of biologically and clinically active substances, biological and pharmacological interactions, and the development of associated research methods, techniques, and clinical trial procedures. Includes instruction in organic chemistry, biochemistry, molecular graphics, rational drug design, toxicology, molecular biology, pharmacology, enzyme mechanisms, receptor theory, neurochemistry, drug metabolism, drug synthesis, biological mechanisms of drug action, research tools and techniques, and laboratory safety.

Of the 117 Medicinal and Pharmaceutical Chemistry degrees granted each year at the Doctors degree research scholarship level, men make up 50% percent and women make up 50% percent of the area of study. Did you know that Indiana has more students graduating with a degree in Medicinal and Pharmaceutical Chemistry than any other state? In fact, Indiana granted 20 degrees last year! The average starting salary for a graduate with a bachelor's degree in Medicinal and Pharmaceutical Chemistry is $38,300.

Popularity of Medicinal and Pharmaceutical Chemistry Degrees in the U.S.
This heat map represents the states that have the highest percent of Medicinal and Pharmaceutical Chemistry degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Careers

The highest paying job for Medicinal and Pharmaceutical Chemistry majors is Health Specialties Teachers, Postsecondary. But, another thing to consider is how much demand there is for certain careers. A position that is in high need that a degree in Medicinal and Pharmaceutical Chemistry can prepare you for is Health Specialties Teachers, Postsecondary.

Top Paying Careers

These are the highest paying careers for Medicinal and Pharmaceutical Chemistry majors.

Most In-Demand Careers

These are the careers in highest demand for Medicinal and Pharmaceutical Chemistry majors.

Student Demographics

Total Students
117
Female Students
58 (49%)
Male Students
59 (50%)
White (49, 42%)
U.S. Nonresident (45, 38%)
Asian (10, 9%)
Hispanic or Latino (7, 6%)
Black or African American (3, 3%)
Two or more races (2, 2%)
Race/ethnicity unknown (1, 1%)
American Indian or Alaska Native (0, <1%)
Native Hawaiian or Other Pacific Islander (0, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen