Select Type of Degree:

Select State:

About Clinical and Industrial Drug Development

A program that focuses on the scientific application of pharmacology, pharmaceutics, and industrial management to the development, production, marketing, and distribution of pharmaceutical products. Includes instruction in industrial microbiology, plasmids, expression vectors, protein chemistry, assay and evaluation, drug synthesis and purification, quality control, industrial management, production security, patent procedures, intellectual property regulations and issues, patent enforcement and defense, and research design and testing.

Students majoring in Clinical and Industrial Drug Development can advance up to a Masters degree. On average, 26% percent of men and 74% percent of women make up the degrees awarded across all college campuses. Clinical and Industrial Drug Development is most popular in Pennsylvania. The Median Starting Salary for a graduate with a bachelor's degree in Clinical and Industrial Drug Development is $38,300.

Popularity of Clinical and Industrial Drug Development Degrees in the U.S.
This heat map represents the states that have the highest percent of Clinical and Industrial Drug Development degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Careers

Majoring in Clinical and Industrial Drug Development, your education can be applied to different careers. Clinical and Industrial Drug Development majors go on to pursue jobs including Health Specialties Teachers, Postsecondary and Natural Sciences Managers which are in high demand. Some of the jobs with the highest salary for Clinical and Industrial Drug Development majors include Natural Sciences Managers, Industrial Production Managers and Health Specialties Teachers, Postsecondary.

Top Paying Careers

These are the highest paying careers for Clinical and Industrial Drug Development majors.

Most In-Demand Careers

These are the careers in highest demand for Clinical and Industrial Drug Development majors.

Student Demographics

Total Students
153
Female Students
113 (73%)
Male Students
40 (26%)
White (60, 39%)
Asian (24, 16%)
U.S. Nonresident (23, 15%)
Race/ethnicity unknown (21, 14%)
Hispanic or Latino (11, 7%)
Black or African American (8, 5%)
Two or more races (6, 4%)
American Indian or Alaska Native (0, <1%)
Native Hawaiian or Other Pacific Islander (0, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen