Chemical and Biomolecular Engineering

Select Type of Degree:

Select State:

About Chemical and Biomolecular Engineering

Chemical and Biomolecular Engineering programs prepare individuals to apply mathematical and scientific principles to the design, development and operational evaluation of systems at the interface of chemical engineering and biology, with an emphasis at the molecular level, such as biopharmaceutical processes, protein engineering, metabolic engineering, gene therapy, biomaterials, cell and tissue engineering, and drug delivery. Includes instruction in chemical engineering, thermodynamics, organic chemistry, biochemistry, momentum and heat transfer, cellular and molecular biotechnology, process design, and chemical reactor design.

For all the 271 degrees granted in Chemical and Biomolecular Engineering per year, the majority of them are Doctors degree research scholarship. Out of the 48 students graduating with degrees at the Doctors degree research scholarship level in the US, 44% percent identify as women and 56% percent identify as men. While students at schools all over the US study Chemical and Biomolecular Engineering, Illinois has the most graduates. The average starting salary for an undergraduate degree in Chemical and Biomolecular Engineering is $69,800.

Popularity of Chemical and Biomolecular Engineering Degrees in the U.S.
This heat map represents the states that have the highest percent of Chemical and Biomolecular Engineering degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Careers

For Chemical and Biomolecular Engineering majors, some of the most in demand jobs include Engineering Teachers, Postsecondary, Engineers, All Other and Chemical Engineers. Not only that, Chemical and Biomolecular Engineering graduates may land a high salary job, such as Chemical Engineers or Engineers, All Other.

Top Paying Careers

These are the highest paying careers for Chemical and Biomolecular Engineering majors.

Most In-Demand Careers

These are the careers in highest demand for Chemical and Biomolecular Engineering majors.

Student Demographics

Total Students
48
Female Students
21 (43%)
Male Students
27 (56%)
U.S. Nonresident (25, 52%)
White (16, 33%)
Hispanic or Latino (2, 4%)
Two or more races (2, 4%)
Asian (1, 2%)
Black or African American (1, 2%)
Race/ethnicity unknown (1, 2%)
American Indian or Alaska Native (0, <1%)
Native Hawaiian or Other Pacific Islander (0, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen