Select Type of Degree:

Select State:

About Biochemistry

A program that focuses on the scientific study of the chemistry of living systems, their fundamental chemical substances and reactions, and their chemical pathways and information transfer systems, with particular reference to carbohydrates, proteins, lipids, and nucleic acids. Includes instruction in bio-organic chemistry, protein chemistry, bioanalytical chemistry, bioseparations, regulatory biochemistry, enzymology, hormonal chemistry, calorimetry, and research methods and equipment operation.

Students majoring in Biochemistry can advance up to a Post masters certificate. On average, 42% percent of men and 58% percent of women make up the degrees awarded across all college campuses. Biochemistry is most popular in California. The Median Starting Salary for an undergraduate degree in Biochemistry is $44,700.

Popularity of Biochemistry Degrees in the U.S.
This heat map represents the states that have the highest percent of Biochemistry degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Careers

Majoring in Biochemistry, your education can be applied to different careers. Biochemistry majors go on to pursue jobs including Biological Technicians and Natural Sciences Managers which are in high demand. Some of the jobs with the highest salary for Biochemistry majors include Natural Sciences Managers, Biochemists and Biophysicists and Medical Scientists, Except Epidemiologists.

Top Paying Careers

These are the highest paying careers for Biochemistry majors.

Student Demographics

Total Students
9,107
Female Students
5,258 (57%)
Male Students
3,849 (42%)
White (4,461, 49%)
Asian (1,798, 20%)
Hispanic or Latino (1,188, 13%)
U.S. Nonresident (530, 6%)
Black or African American (447, 5%)
Two or more races (436, 5%)
Race/ethnicity unknown (213, 2%)
American Indian or Alaska Native (22, <1%)
Native Hawaiian or Other Pacific Islander (12, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen