Select Type of Degree:

Select State:

About Structural Biology

A program that focuses on the scientific study of submolecular and molecular components and assemblies of living systems and how they are organized into functional units such as cells and anatomic tissues. Includes instruction in glycoprotein, carbohydrate, protein, and nucleic acid structures and chemistry; cytoskeletal structure; nuclear and intracellular structures; molecular recognition; molecular chaperones; transcription and folding; multicellular organization; microtubules and microfilaments; cell differentiation; immunophysics; and DNA sequencing.

Students who are interested in Structural Biology can study up to a Masters degree. Currently, 18 students earn a some level of degree in Structural Biology around the US each year. More students graduate with a degree in Structural Biology in the state of California compared to any other state. The average starting salary for a graduate with a bachelor's degree in Structural Biology is $44,700.

Popularity of Structural Biology Degrees in the U.S.
This heat map represents the states that have the highest percent of Structural Biology degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Careers

The highest paying job for Structural Biology majors is Natural Sciences Managers. But, something else to consider is how many job openings there currently is. A job that is in high need that a degree in Structural Biology can prepare you for is Biological Science Teachers, Postsecondary.

Top Paying Careers

These are the highest paying careers for Structural Biology majors.

Most In-Demand Careers

These are the careers in highest demand for Structural Biology majors.

Student Demographics

Total Students
3
Female Students
2 (66%)
Male Students
1 (33%)
Hispanic or Latino (1, 33%)
Black or African American (1, 33%)
Two or more races (1, 33%)
Asian (0, <1%)
American Indian or Alaska Native (0, <1%)
White (0, <1%)
Native Hawaiian or Other Pacific Islander (0, <1%)
U.S. Nonresident (0, <1%)
Race/ethnicity unknown (0, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen