Genome Sciences/Genomics

Select Type of Degree:

Select State:

About Genome Sciences/Genomics

A program that focuses on the scientific study of whole genome sequences and patterns of gene expression. Includes instruction in molecular and cellular biology, genetics, protein technologies, genomic sciences and techniques, bioinformatics, and scientific and research ethics.

While Genome Sciences/Genomics offers degrees up to the Masters degree, the majority of students earn a Masters degree. Students major in Genome Sciences/Genomics all around the US, though the major at the Doctors degree research scholarship level sees the most graduates in North Carolina. The average starting salary for a graduate with a bachelor's degree in Genome Sciences/Genomics is $42,090.

Popularity of Genome Sciences/Genomics Degrees in the U.S.
This heat map represents the states that have the highest percent of Genome Sciences/Genomics degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Careers

Some top careers related to Genome Sciences/Genomics, include Natural Sciences Managers and Biological Scientists, All Other, both of which have lots of job openings. Though there are positions that pay more, such as Natural Sciences Managers. the most in-demand position for Genome Sciences/Genomics majors is Biological Science Teachers, Postsecondary.

Top Paying Careers

These are the highest paying careers for Genome Sciences/Genomics majors.

Most In-Demand Careers

These are the careers in highest demand for Genome Sciences/Genomics majors.

Student Demographics

Total Students
21
Female Students
7 (33%)
Male Students
14 (66%)
White (13, 62%)
Hispanic or Latino (3, 14%)
U.S. Nonresident (2, 10%)
Asian (1, 5%)
Two or more races (1, 5%)
Race/ethnicity unknown (1, 5%)
American Indian or Alaska Native (0, <1%)
Black or African American (0, <1%)
Native Hawaiian or Other Pacific Islander (0, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen