Select Type of Degree:

Select State:

About Cell Physiology

A program that focuses on the scientific study of physiological processes operating within and among cells, and intracellular communication and behavior, in the context of larger systems and whole organisms. Includes instruction in cell and molecular biology, molecular physiology, cell cycle control, signal transduction, protein structure, membrane biochemistry and structure, ion channel physics, cell respiration and digestion, secretory functions, cell adhesion and communication, information encoding and decoding, and the relation of cell physiology to tissue, organ, and organismic functioning.

Students studying Cell Physiology can advance up to a Masters degree. On average, 45% percent of men and 55% percent of women make up the degrees awarded across all college campuses. Cell Physiology is has the largest number of granted degrees in California. The Median Starting Salary for an undergraduate degree in Cell Physiology is $42,090.

Popularity of Cell Physiology Degrees in the U.S.
This heat map represents the states that have the highest percent of Cell Physiology degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Careers

Majoring in Cell Physiology, your experience can be applied to different careers. Cell Physiology majors go on to pursue jobs including Medical Scientists, Except Epidemiologists and Biological Science Teachers, Postsecondary which are in high demand. Some of the jobs with the highest salary for Cell Physiology majors include Medical Scientists, Except Epidemiologists, Biological Science Teachers, Postsecondary .

Top Paying Careers

These are the highest paying careers for Cell Physiology majors.

Most In-Demand Careers

These are the careers in highest demand for Cell Physiology majors.

Student Demographics

Total Students
20
Female Students
11 (55%)
Male Students
9 (45%)
White (11, 55%)
U.S. Nonresident (5, 25%)
Asian (3, 15%)
Black or African American (1, 5%)
American Indian or Alaska Native (0, <1%)
Hispanic or Latino (0, <1%)
Native Hawaiian or Other Pacific Islander (0, <1%)
Two or more races (0, <1%)
Race/ethnicity unknown (0, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen