Select Type of Degree:

Select State:

About Endocrinology

A program that focuses on the scientific study of the composition, manufacture, and secretion of protein compounds by cells and glands and the role of endocrine substances in bodily processes. Includes instruction in protein chemistry, protein secretion, membrane biogenesis and transfer methods, cellular communication, gene and cell regulation, cytochemistry, fractionation, radioautography, and applications such as neuroendocrinology.

While Endocrinology has degrees up to the Masters degree, the majority of students earn a Masters degree. Students major in Endocrinology all over the country, though the major at the Doctors degree research scholarship level has the most graduates in California. The average starting salary for an undergraduate degree in Endocrinology is $42,090.

Popularity of Endocrinology Degrees in the U.S.
This heat map represents the states that have the highest percent of Endocrinology degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Careers

Some top jobs related to Endocrinology, include Biological Science Teachers, Postsecondary, which have many employment opportunities. Though there are jobs that pay more, like Medical Scientists, Except Epidemiologists. The most in-demand position for Endocrinology majors is Medical Scientists, Except Epidemiologists.

Top Paying Careers

These are the highest paying careers for Endocrinology majors.

Most In-Demand Careers

These are the careers in highest demand for Endocrinology majors.

Student Demographics

Total Students
6
Female Students
4 (66%)
Male Students
2 (33%)
White (3, 50%)
U.S. Nonresident (2, 33%)
Asian (1, 17%)
American Indian or Alaska Native (0, <1%)
Hispanic or Latino (0, <1%)
Black or African American (0, <1%)
Native Hawaiian or Other Pacific Islander (0, <1%)
Two or more races (0, <1%)
Race/ethnicity unknown (0, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen