Select Type of Degree:

Select State:

About Marriage and Family Therapy/Counseling

Marriage and Family Therapy/Counseling programs prepare individuals for the independent professional practice of marriage and family therapy, involving the diagnosis of cognitive, affective, and behavioral domain disorders, both mental and emotional, within the context of marriage and family systems and the application of short- and long-term therapeutic strategies in family group contexts. Includes instruction in psychotherapy, family systems and studies, small group intervention and therapy, marital problems, depression, identification of psychopathologies and behavioral disorders, holistic health care, practice management, applicable regulations, and professional standards and ethics.

Of the 115 Marriage and Family Therapy/Counseling degrees granted each year at the Doctors degree research scholarship level, women make up 83% percent and men make up 17% percent of the field of study. Did you know that California has more students graduating with a degree in Marriage and Family Therapy/Counseling than any other state in the US? In fact, California awarded 47 degrees last year! The average annual income for a graduate with a bachelor's degree in Marriage and Family Therapy/Counseling is $37,200.

Popularity of Marriage and Family Therapy/Counseling Degrees in the U.S.
This heat map represents the states that have the highest percent of Marriage and Family Therapy/Counseling degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Careers

The highest paying career for Marriage and Family Therapy/Counseling majors is Psychology Teachers, Postsecondary. However, another thing to think about is how many job openings there currently is. A job that is in high need that a degree in Marriage and Family Therapy/Counseling can prepare you for is Psychology Teachers, Postsecondary.

Top Paying Careers

These are the highest paying careers for Marriage and Family Therapy/Counseling majors.

Most In-Demand Careers

These are the careers in highest demand for Marriage and Family Therapy/Counseling majors.

Student Demographics

Total Students
115
Female Students
95 (82%)
Male Students
20 (17%)
White (46, 40%)
Black or African American (29, 25%)
Hispanic or Latino (14, 12%)
Two or more races (7, 6%)
Race/ethnicity unknown (7, 6%)
Asian (6, 5%)
U.S. Nonresident (5, 4%)
Native Hawaiian or Other Pacific Islander (1, 1%)
American Indian or Alaska Native (0, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen