Select Type of Degree:

Select State:

About Biochemistry

A program that focuses on the scientific study of the chemistry of living systems, their fundamental chemical substances and reactions, and their chemical pathways and information transfer systems, with particular reference to carbohydrates, proteins, lipids, and nucleic acids. Includes instruction in bio-organic chemistry, protein chemistry, bioanalytical chemistry, bioseparations, regulatory biochemistry, enzymology, hormonal chemistry, calorimetry, and research methods and equipment operation.

Students majoring in Biochemistry can advance up to a Post masters certificate. On average, 43% percent of men and 57% percent of women make up the degrees awarded across all college campuses. Biochemistry is most popular in Arizona. The Median Starting Salary for an undergraduate degree in Biochemistry is $44,700.

Popularity of Biochemistry Degrees in the U.S.
This heat map represents the states that have the highest percent of Biochemistry degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Careers

Majoring in Biochemistry, your education can be applied to different careers. Biochemistry majors go on to pursue jobs including Biological Technicians and Food Science Technicians which are in high demand. Some of the jobs with the highest salary for Biochemistry majors include Biological Technicians, Food Science Technicians .

Top Paying Careers

These are the highest paying careers for Biochemistry majors.

Most In-Demand Careers

These are the careers in highest demand for Biochemistry majors.

Student Demographics

Total Students
14
Female Students
8 (57%)
Male Students
6 (42%)
White (7, 50%)
Hispanic or Latino (3, 21%)
Race/ethnicity unknown (2, 14%)
American Indian or Alaska Native (1, 7%)
Black or African American (1, 7%)
Asian (0, <1%)
Native Hawaiian or Other Pacific Islander (0, <1%)
Two or more races (0, <1%)
U.S. Nonresident (0, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen