Select Type of Degree:

Select State:

About Biotechnology

A program that focuses on the application of the biological sciences, biochemistry, and genetics to the preparation of new and enhanced agricultural, environmental, clinical, and industrial products, including the commercial exploitation of microbes, plants, and animals. Includes instruction in bioinformatics, gene identification, phylogenetics and comparative genomics, bioinorganic chemistry, immunoassaying, DNA sequencing, xenotransplantation, genetic engineering, industrial microbiology, drug and biologic development, enzyme-based production processes, patent law, biotechnology management and marketing, applicable regulations, and biotechnology ethics.

Students who are passionate about Biotechnology can study up to a Masters degree. Currently, 3,200 students are granted some level of degree in Biotechnology around the US each year. More students graduate with a degree in Biotechnology in the state of North Carolina compared to any other state. The average starting salary for a graduate with a bachelor's degree in Biotechnology is $42,090.

Popularity of Biotechnology Degrees in the U.S.
This heat map represents the states that have the highest percent of Biotechnology degrees compared to all other degrees awarded in that state.
Created with Raphaël 2.1.0
Created with Raphaël 2.1.0HIAKFLSCGAALNCTNRICTMAMENHVTNYNJPADEMDWVKYOHMIWYMTIDWATXCAAZNVUTCONMORNDSDNEIAMSINILMNWIMOAROKKSLAVA
Created with Raphaël 2.1.0Simplemaps.comBuilt with SimpleMaps
Less Popular
More Popular

Student Demographics

Total Students
161
Female Students
109 (67%)
Male Students
52 (32%)
White (78, 48%)
Hispanic or Latino (23, 14%)
Black or African American (23, 14%)
Asian (14, 9%)
U.S. Nonresident (12, 7%)
Race/ethnicity unknown (7, 4%)
American Indian or Alaska Native (2, 1%)
Two or more races (2, 1%)
Native Hawaiian or Other Pacific Islander (0, <1%)

Subscribe to Our Newsletter

Join thousands of students and parents learning about finding the right college, admissions secrets, scholarships, financial aid, and more.

College Raptor Loading Screen College Raptor Loading Screen